PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02761g04008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 196aa    MW: 22170.6 Da    PI: 10.1575
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02761g04008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83.1e-18107141135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf02761g04008.1 107 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 141
                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.0E-701192IPR016679Transcription factor, GATA, plant
SMARTSM004012.0E-15101151IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.477101137IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15102165No hitNo description
Gene3DG3DSA:3.30.50.106.0E-14105139IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.36E-12106153No hitNo description
PROSITE patternPS003440107132IPR000679Zinc finger, GATA-type
PfamPF003204.5E-16107141IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
SDDVAELEWL SNFVEDSSNN YPSNSLTGTI NLNSSNTSFH SKSRSKRSRA TTANTNWASS  60
LQQAHQKPTD EKPNQSPQYN NNNNTMKPKK ESSRGRSCEM SDIPRKCTHC ASEKTPQWRT  120
GPLGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFVLTQHSN SHRKVMELRR QKEVQQQSQQ  180
GMYGHHFQTF IVLVII